Address
Skye Research, 11400 West Olympic Blvd, Los Angeles, CA 90064

LL-37 5 mg
$74.00
Buy LL-37 Online
The Definitive Amphipathic Peptide for Investigating Innate Immune Response and Antimicrobial Barrier Homeostasis. LL-37 is a 37-amino acid linear peptide and the only human member of the cathelicidin family, functioning as a multifaceted effector molecule that modulates inflammatory signaling and cellular chemotaxis. Skye Peptides provides this foundational research reagent with a reputation for fast, reliable shipping. Every batch is 99%+ purity verified via independent Third-Party Lab Testing, supported by a Full Certificate of Analysis (COA) for uncompromising molecular precision.
LL-37 Research Analysis: Investigating Pleiotropic Immunomodulatory Signaling
In the landscape of modern molecular biology, the pharmacological regulation of host defense peptides represents a critical frontier in addressing systemic decline within mucosal and epithelial environments. Researchers looking to buy LL-37 online trust Skye Peptides for consistent batch-to-batch fidelity and analytical transparency. This cationic polypeptide serves as a primary substrate for investigating the bypass of traditional antibiotic resistance while stabilizing neuronal proteostasis and immunological balance in advanced laboratory models.
Technical Profile of LL-37
LL-37 is a synthetic version of the C-terminal fragment of the human CAP18 protein, characterized by an amphipathic $\alpha$-helical structure. As detailed in LL-37 Lab Results, this peptide consists of 37 amino acids starting with a double leucine ($[LL-37, 37 aa]$) and maintains a molecular weight of approximately $4493.3$ Da.
Mechanisms of Action in Laboratory Models
Investigating LL-37 research data requires an objective analysis of its interactions with formyl peptide receptors and intracellular signaling cascades:
-
Agonism of Formyl Peptide Receptor-Like 1 (FPR2): LL-37 facilitates the study of leukocyte chemotaxis, investigating the peptide’s ability to recruit neutrophils, monocytes, and T-cells to sites of experimental inflammation.
-
Modulation of Toll-Like Receptor (TLR) Signaling: Research focuses on the peptide’s capacity to neutralize lipopolysaccharides (LPS) and modulate transcriptional activity of pro-inflammatory cytokines, providing a model for investigating the stabilization of the innate immune response.
-
Induction of MAPK and PI3K/Akt Protein Phosphorylation: This reagent is utilized to study the intracellular signaling pathways that promote re-epithelialization and investigate the mitigation of stress-induced apoptosis in dermal and mucosal models.
-
Direct Microbial Membrane Permeabilization: Study of the LL-37 ligand involves analyzing its ability to disrupt bacterial lipid bilayers via “toroidal pore” or “carpet” mechanisms, investigating the preservation of cellular resilience against pathogenic challenge.
Primary Research Applications
The molecular profile of LL-37 5 mg makes it a priority for several high-level fields of study:
-
Immunological Homeostasis: Exploring the role of cathelicidins in restoring homeostatic signaling and investigating the preservation of cellular resilience in models of chronic autoimmune challenge.
-
Dermatological Sciences and Wound Healing: Investigating the stabilization of structural tissue repair and the role of LL-37 in preventing infectious-induced systemic decline in dermal tissue.
-
Neuro-Regeneration: Analyzing the peptide’s ability to influence neuro-protective signaling and modulate the inflammatory response within the central nervous system to counteract systemic decline.
-
Peptidomimetics: Studying the interplay between $\alpha$-helical stability and the bypass of rapid proteolytic degradation to enhance the pharmacological longevity of host defense ligands.
Why Source from Skye Peptides?
When procuring advanced research ligands like LL-37, analytical transparency is the only metric that matters. We set the industry benchmark for:
-
Third-Party Verification (Janoshik/MZ Biolabs): We do not simply claim purity; we prove it. Every batch undergoes rigorous HPLC and LC-MS/MS testing by independent facilities.
-
Clinical-Grade Lyophilization: Our peptides are flash-frozen and vacuum-dried to ensure maximum structural stability and a shelf-life optimized for long-term laboratory analysis.
-
Rapid North American Logistics: Our specialized logistics infrastructure ensures that your research materials are shipped within 24 hours, arriving in a state of absolute stasis.
-
Bulk Research Incentives: Institutional clients can leverage significant scaling discounts. To maximize your procurement budget, apply a skye peptides promo code. You can also consult our verified LL-37 Lab Results to confirm our commitment to technical excellence.
Disclaimer: This product is intended for Laboratory Research Use Only. It is not for human consumption, medical, or diagnostic use.



